PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.5KG212400.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family MIKC_MADS
Protein Properties Length: 110aa    MW: 12736.5 Da    PI: 10.82
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.5KG212400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF85.72.8e-271059251
                         ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
               SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                         ri+n +nrqvtfskRr g++KKA EL +LCda+v +++fs tg+lye+ss
  Pavir.5KG212400.1.p 10 RIDNRTNRQVTFSKRRSGLMKKARELAILCDADVGLVVFSFTGRLYEFSS 59
                         9***********************************************96 PP

2K-box15.28.7e-07851091236
                K-box  12 akaeslqqelakLkkeienLqreqR 36 
                          ++a+ +q e+a L+++++nLq+++R
  Pavir.5KG212400.1.p  85 SEAKFWQMEVATLRQQVQNLQNNNR 109
                          6889*****************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006631.202161IPR002100Transcription factor, MADS-box
SMARTSM004325.3E-38160IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.49E-32280IPR002100Transcription factor, MADS-box
CDDcd002653.83E-41271No hitNo description
PRINTSPR004043.7E-28323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003191.6E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004043.7E-282338IPR002100Transcription factor, MADS-box
PRINTSPR004043.7E-283859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 110 aa     Download sequence    Send to blast
MGRGKIAIQR IDNRTNRQVT FSKRRSGLMK KARELAILCD ADVGLVVFSF TGRLYEFSSS  60
SMKTTIERYQ EAREENNCRF LNPISEAKFW QMEVATLRQQ VQNLQNNNR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P3e-21179179Myocyte-specific enhancer factor 2B
1tqe_Q3e-21179179Myocyte-specific enhancer factor 2B
1tqe_R3e-21179179Myocyte-specific enhancer factor 2B
1tqe_S3e-21179179Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004967658.14e-63PREDICTED: MADS-box transcription factor 25-like
SwissprotQ84NC52e-62MAD25_ORYSJ; MADS-box transcription factor 25
TrEMBLA0A0D9ZIP38e-62A0A0D9ZIP3_9ORYZ; Uncharacterized protein
TrEMBLI1PK122e-61I1PK12_ORYGL; Uncharacterized protein
TrEMBLQ01ME42e-61Q01ME4_ORYSA;
STRINGORGLA04G0053100.17e-61(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP12938398
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37940.17e-44AGAMOUS-like 21